PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG096100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 102aa    MW: 11533.2 Da    PI: 11.7814
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG096100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.72e-154274234
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-E CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdae 34
                         rie+ + rqv fskRr+g++KKA+EL  LCdae
  Pavir.5NG096100.2.p 42 RIEDRISRQVRFSKRRAGLFKKAFELWLLCDAE 74
                         8******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-113286IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.3853374IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-123555IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-153674IPR002100Transcription factor, MADS-box
PfamPF003192.4E-144274IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-125570IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MAHLPAAARS DWRRPGFPAG GRRAAGARAK AMLRHGRVEL RRIEDRISRQ VRFSKRRAGL  60
FKKAFELWLL CDAENQDDAS SDLKSRIKEI TTWSLQNNAE S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1848195e-42KF184819.1 Saccharum hybrid cultivar R570 clone BAC 004J16 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008673731.11e-23PREDICTED: truncated transcription factor CAULIFLOWER D-like
TrEMBLA0A0A9D7Q68e-24A0A0A9D7Q6_ARUDO; Uncharacterized protein
STRINGGRMZM2G171650_P055e-23(Zea mays)
STRINGGRMZM2G320549_P023e-23(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.16e-15MIKC_MADS family protein